c-Met receptor raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
This page was last updated on 2025-10-17 and is reviewed periodically as new material appears.
Development of dihexa followed from studies on angiotensin IV analogs and their effects on learning and memory. Researchers sought compounds with improved metabolic stability and brain penetration compared with natural peptides. In preclinical reports, dihexa was associated with changes in synaptic connectivity and performance on spatial tasks. These findings generated interest in its potential as a cognitive research tool. The work remains largely preclinical, and independent replication has been limited.
Regulatory and commercial contexts differ from clinical medicine. Dihexa is not approved as a drug by major agencies, and no published human trials establish its safety or efficacy. It is often sold as a research chemical labeled for laboratory use only. Suppliers may provide certificates of analysis, but purity and identity depend on the specific batch. Legal status varies by country and may treat such compounds as unapproved substances for human consumption.
The leading hypothesis for dihexa centers on hepatocyte growth factor (HGF) and its receptor, c-Met. In cell-based assays, dihexa has been reported to potentiate HGF-dependent signaling. That pathway influences cell growth, survival, and motility. Because c-Met signaling is widespread, the proposed mechanism is broad rather than specific to neurons. The exact binding site and stoichiometry remain areas of active investigation, and independent replication is limited. This uncertainty limits firm conclusions about how the compound acts in living organisms.
Animal studies have examined dihexa in models of cognitive impairment, synaptic plasticity, and memory. Some reports describe improved performance on maze or avoidance tasks after administration. These findings are preclinical and often involve small samples, varied routes, and differing formulations. Results in rodents do not establish effects in humans. The absence of published randomized controlled trials in people is a major gap in the evidence base. Observational reports and user accounts do not substitute for controlled clinical data.
| Property | Value | Notes |
|---|---|---|
| Chemical class | Synthetic angiotensin IV analog | Peptidomimetic |
| Appearance | White to off-white powder | Lyophilized solid |
| Solubility | Soluble in DMSO; limited in water | Typical for small peptides |
| Storage | -20 °C, desiccated | Protect from light and moisture |
| Analytical method | HPLC with UV detection | Purity and identity checks |
Dihexa is a synthetic peptide derived from angiotensin IV, a naturally occurring fragment of the renin-angiotensin system. Researchers modified the angiotensin IV structure to improve metabolic stability and central nervous system activity. It is frequently described as a hepatocyte growth factor mimetic because it can activate the c-Met receptor pathway in experimental systems. Its development reflects interest in small peptides that influence synaptic plasticity and cognitive processes. Most information comes from preclinical studies rather than controlled human trials.
The compound has been examined in animal models for effects on learning, memory, and synaptic connectivity. Some reports describe increased dendritic spine density and improved performance on certain behavioral tasks after administration in rodents. These findings are often cited in discussions of nootropic research peptides, but replication across independent laboratories remains limited. The absence of published phase 1 or phase 2 clinical trial data makes it difficult to assess safety, effective routes, or long-term outcomes in humans. Consequently, claims about cognitive benefits in people remain speculative.
Dihexa is not approved as a medicine in major regulatory jurisdictions. It is commonly sold as a research chemical for laboratory use, though such products may not be standardized or independently verified. Scientific literature on dihexa includes in vitro assays, rodent studies, and reviews that discuss its proposed mechanism. The distinction between peer-reviewed findings and commercial promotion is important when evaluating available information. Open questions include its precise binding interactions, pharmacokinetics, and whether animal results translate to human biology.
Regulatory agencies have not approved dihexa as a prescription drug or supplement. In many countries it falls into a gray area when sold for laboratory research. Buyers may encounter products marketed for research use only, which are not intended for human consumption. Purity and identity can vary between suppliers and batches. Certificates of analysis and independent testing are often recommended for research materials. Documentation helps verify what a vial contains.
Discussion of dihexa in online communities sometimes outpaces the scientific record. Anecdotal reports are difficult to verify and may not distinguish effects from placebo or expectation. The absence of approved human data means long-term risks remain unknown. Researchers continue to investigate related compounds and pathways. Open questions include whether animal findings translate to humans and which biological targets matter most. No consensus exists on these points. Current reviews emphasize the need for rigorous clinical research.
Dihexa is a synthetic peptide with the chemical name N-hexanoic-Tyr-Ile-(6)-aminohexanoic amide, and it is structurally related to angiotensin IV, a naturally occurring peptide fragment. Researchers developed it as a modified analog intended to alter stability and activity relative to the parent peptide. Its short sequence and fatty acid chain distinguish it from many endogenous peptides, and published studies often describe it under the abbreviation dihexa. The compound is classified as a laboratory compound rather than an approved therapeutic in most jurisdictions.
Early laboratory work focused on its effects on synaptic connectivity and neuronal signaling. In cell and animal models, dihexa has been reported to promote the formation of new synapses, a process called synaptogenesis. These findings have generated interest in cognitive research, but the evidence base remains mostly preclinical. Human clinical trials with clear safety and efficacy endpoints are limited or absent in the public literature. Whether these effects translate to humans is an open question.
The proposed mechanism involves interaction with the hepatocyte growth factor (HGF) system and its receptor, c-Met. Dihexa is described in some studies as an HGF mimetic, meaning it may mimic or enhance HGF-mediated signaling. Activation of c-Met can influence cell growth, survival, and cytoskeletal remodeling, pathways that intersect with synaptic plasticity. However, the precise binding targets and downstream events for dihexa are not fully established, and alternative mechanisms have been suggested.
Additionally, a 2020 study indicates that Tyrannosaurus and other tyrannosaurids were exceptionally efficient walkers. Studies by Dececchi et al., compared the leg proportions, body mass, and the gaits of more than 70 species of theropod dinosaurs including Tyrannosaurus and its relatives. The research team then applied a variety of methods to estimate each dinosaur's top speed when running as well as how much energy each dinosaur expended while moving at more relaxed speeds such as when walking. Among smaller to medium-sized species such as dromaeosaurids, longer legs appear to be an adaptation for faster running, in line with previous results by other researchers. But for theropods weighing over 1,000 kg (2,200 lb), top running speed is limited by body size, so longer legs instead were found to have correlated with low-energy walking. The results further indicate that smaller theropods evolved long legs as a means to both aid in hunting and escape from larger predators while larger theropods that evolved long legs did so to reduce the energy costs and increase foraging efficiency, as they were freed from the demands of predation pressure due to their role as apex predators. Compared to more basal groups of theropods in the study, tyrannosaurs like Tyrannosaurus itself showed a marked increase in foraging efficiency due to reduced energy expenditures during hunting or scavenging. This in turn likely resulted in tyrannosaurs having a reduced need for hunting forays and requiring less food to sustain themselves as a result.
Buspirone acts primarily on the serotonin 5-HT1A receptor. It behaves as a full agonist at presynaptic 5-HT1A autoreceptors in the dorsal raphe, reducing the firing of serotonin-producing neurons, and as a partial agonist at postsynaptic 5-HT1A receptors in forebrain regions. This difference in activity between presynaptic and postsynaptic sites is thought to result from variations in receptor density and coupling efficiency. Buspirone also has lower affinity for other serotonin receptors, including 5-HT2A, 5-HT2B, 5-HT2C, 5-HT6, and 5-HT7, where it is thought to act primarily as an antagonist. In addition, buspirone has weak antagonistic activity at dopamine D2, D3, and D4 receptors, with preferential blockade of presynaptic D2 autoreceptors at low doses and postsynaptic D2 receptors only at higher doses. A major metabolite of buspirone, 1-(2-pyrimidinyl)piperazine (1-PP), circulates at higher levels than buspirone itself and is a potent α2-adrenergic receptor antagonist, which may contribute to some of buspirone's noradrenergic and dopaminergic effects. Buspirone has very weak affinity for α1-adrenergic receptors, and does not interact with the GABAA receptor. Buspirone has been found to produce antiaggressive effects in rodents. It can strongly increase oxytocin levels in rodents, maximally by up to 9-fold. Conversely, the drug did not affect oxytocin levels in humans, though it enhanced hypoglycemia-induced oxytocin elevation.
Biden's approval rating in January 2025 was 40%, which was low but still higher than several other presidents' final approval ratings. Gallup's averaged polls of Biden's presidency found that he was the second-least popular president in its polling history, after Trump. CNN and CBS News found Biden's final approval rating to be 37% and 36%, respectively. Polling aggregator FiveThirtyEight found that Biden had a final average approval rating of 37%.
Sources: en.wikipedia.org
81.9% of voters decided for Baden to remain part of Baden-Württemberg, only 18.1% opted for the reconstitution of the old state of Baden. The referendums in Lower Saxony and Rhineland-Palatinate were held on 19 January 1975 (the percentages given are the percentages of those eligible who voted in favour):
Medicinal Plant Images Database—School of Chinese Medicine, Hong Kong Baptist University (in Chinese) Chinese Medicine Specimen Database—School of Chinese Medicine, Hong Kong Baptist University (in Chinese) Literary Review Compilation on Traditional Chinese Medicine, PDF, 133 pages; compiled by the Association Québécoise des Thérapeutes Naturels (AQTN)
Two polypeptides. A large subunit of 104 amino acids (sequence TMWGTKWCGSGNEATDISELGYWSNLDSCCRTHDHCDNIPSGQTKYGLTNEGKYTMMNCKCETAFEQCLRNVTGGMEGPAAGFVRKTYFDLYGNGCYNVQCPSQ) and a smaller one of 27 amino acids (sequence SEECPDGVATYTGEAGYGAWAINKLNG). Subunits are linked by a disulfide bond. Phospholipase A2 (PLA2) activity on the large subunit. The molecular weight of the toxin is 15 kDa. Like IpTxa, IpTxi acts on RyR. When an action potential reaches the muscle, RyR channels open and Ca2+ becomes available in the cell to induce contraction. The presence of Ca2+ induces the large subunit of IpTxi to hydrolyze the Sn2 fatty acyl bond from the membrane of the sarcoplasmatic reticulum. This process is executed by PLA2 activity. The freed fatty acids bind to the RyR itself or to a closely associated protein linked to gating. Binding of the RyR induces blocking of the channel. When the concentration of free fatty acids is low there will be an incomplete block of RyR; higher concentrations will give a complete block. Because IpTxi also works on the RyR channels of the heart muscles, it could potentially be used as a drug against arrhythmia. This has not yet been proven, and must be studied in vivo first.
Sources: en.wikipedia.org
=== Additives and flavoring === To achieve a buttery profile in cultured lines, manufacturers can add small amounts of citrate-fermenting lactococci or Leuconostoc bacterial strains to the starter mix to produce diacetyl. Producers typically maintain a diacetyl-to-acetaldehyde ratio of 3–5 to 1; deviations from this ratio alter the sensory profile, with lower ratios yielding notes described as grassy and higher ratios yielding a sharper taste. Titanium dioxide (E171) is added to some commercial brands to act as an opaque whitening agent. While permitted up to 1% of total volume by weight in the United States by the Food and Drug Administration (FDA), its global usage has declined due to shifting regional regulations on nanoparticle technology in food ingredients. Following a 2021 assessment by the European Food Safety Authority (EFSA) highlighting unresolved genotoxicity and nanoparticle accumulation concerns, the European Union implemented a full ban on E171 in food products starting in August 2022. In contrast, the United Kingdom represents a distinct post-Brexit regulatory divergence. The UK Food Standards Agency (FSA), alongside the Committee on Toxicity (COT) and the Committee on Mutagenicity (COM), reviewed the EFSA evidence and concluded that the dietary risk of genotoxicity from food-grade E171 was low. Consequently, titanium dioxide remains a permitted food additive in Great Britain under retained domestic food law.
This enzyme participates in the pentose phosphate pathway (see image), a metabolic pathway that supplies reducing energy to cells (such as erythrocytes) by maintaining the level of the reduced form of the co-enzyme nicotinamide adenine dinucleotide phosphate (NADPH). The NADPH in turn maintains the level of glutathione in these cells that helps protect the red blood cells against oxidative damage from compounds like hydrogen peroxide. Of greater quantitative importance is the production of NADPH for tissues involved in biosynthesis of fatty acids or isoprenoids, such as the liver, mammary glands, adipose tissue, and the adrenal glands. G6PD reduces NADP+ to NADPH while oxidizing glucose-6-phosphate. Glucose-6-phosphate dehydrogenase is also an enzyme in the Entner–Doudoroff pathway, a type of glycolysis. Clinically, an X-linked genetic deficiency of G6PD makes a human prone to non-immune hemolytic anemia.
Semaglutide is chemically similar to human GLP-1. The first six amino acids of GLP-1 are missing. Substitutions are made at GLP positions 8 and 34 (semaglutide positions 2 and 28), where alanine and lysine are replaced by 2-aminoisobutyric acid and arginine, respectively. The substitution of the alanine prevents chemical breakdown by dipeptidyl peptidase-4. The lysine at GLP position 26 (semaglutide position 20) has a long chain attached, ending with a chain of 18 carbon atoms and a carboxyl group. This increases the drug's binding to blood protein (albumin), which enables longer presence in the blood circulation. Semaglutide's half-life in the blood is about seven days (165–184 hours).
=== Relation to the Avogadro constant === The number of entities (symbol N) in a one-mole sample equals the Avogadro number (symbol N0), a dimensionless quantity. The Avogadro constant (symbol NA) is given by the Avogadro number multiplied by the unit reciprocal mole (mol−1), i.e. NA = N0/mol. The ratio n = N/NA is a measure of the amount of substance (with the unit mole). The Avogadro constant was determined by a measurement of the number of 28Si atoms in a single crystalline sample.
Sources: en.wikipedia.org
Dihexa is a synthetic peptidomimetic related to angiotensin IV. It is studied in preclinical research for effects on synaptic signaling and cognition. It is not an approved medication.
No major drug regulatory agency has approved dihexa for human use. Published human clinical trials are absent, so its safety and efficacy are not established. It is commonly sold for laboratory research only.
It was developed from research on angiotensin IV analogs and peptide stability. The goal was to find compounds with better brain penetration and metabolic resistance. Early studies used rodent models rather than human participants.
It is thought to enhance hepatocyte growth factor signaling through the c-Met receptor. This pathway is involved in cell growth and repair. The precise molecular details are not fully established.